Protein Design
Shuguang Zhang (MIT)
TA: Thras Karydis (DeepCure)
Class Outline: http://fab.cba.mit.edu/classes/S63.21/class_site/pages/class_3.html
Skills covered:
Databases:
- Uniprot: A comprehensive, high-quality and freely accessible resource of protein sequence and functional information. It is linked to almost every other database. Example Entry: G3ECR1
- RCSB: Collection of all publicly available biological macromolecular structures. Example Entry: 4CMP
- PFAM: A large collection of protein families, i.e. groups of proteins with similar sequence/function. Example Entry: PF02171
- SCOP: A large collection of structural protein families. Proteins are organized according to their structural and evolutionary relationships. Example Entry: 6PGDH C-terminal helical region-like
- ExPaSy: SIB Bioinformatics Resource Portal which provides access to scientific databases and software tools (i.e., resources) in different areas of life sciences including proteomics, genomics, phylogeny, systems biology, population genetics, transcriptomics etc.
3D Molecule Visualization Software:
- PyMOL(https://pymol.org/edu/?q=educational): PyMOL is a user-sponsored molecular visualization system on an open-source foundation, maintained and distributed by Schrödinger.
- Chimera: A highly extensible program for interactive visualization and analysis of molecular structures and related data, including density maps, supramolecular assemblies, sequence alignments, docking results, trajectories, and conformational ensembles.
- VMD: A molecular visualization program for displaying, animating, and analyzing large biomolecular systems using 3-D graphics and built-in scripting
- NGLViewer: NGL Viewer is a collection of tools for web-based molecular graphics. WebGL is employed to display molecules like proteins and DNA/RNA with a variety of representations.
Sequence alignment and homology:
- BLAST: BLAST finds regions of similarity between biological sequences. The program compares nucleotide or protein sequences (pBLAST) to sequence databases and calculates the statistical significance.
- Clustal Omega: A new multiple sequence alignment program that uses seeded guide trees and HMM profile-profile techniques to generate alignments between three or more sequences.
Homework
Part A: Exercises
1) Answer any of the following questions:
- How many molecules of amino acids do you take with a piece of 500 grams of meat? (on average an amino acid is ~100 Daltons)
I ended up finding out on Google that 1 gram is 6.022173643 x 10²³ Daltons. So 500 grams of meat would be 3.011x10²⁶ Daltons, and when you divide that by 100 (the average weight of an amino acid), 500 grams of meat would probably have 3.011x10²⁴ molecules! Wow!
- Why are there only 20 natural amino acids?
I don't have a great guess at this, but my main guess is that 20 natural amino acids have been optimized with the biological machinery that is naturally occuring.
- Why most molecular helices are right handed?
Biology likes to conserve as much energy as possible. There are also less iterferences with the formation of being right handed than left handed.
- Where did amino acids come from before enzymes that make them, and before life started?
I think they came from the bottom of the sea. Let me check. Yes so its hypothesized that they came from the bottom of the sea near the earth's crust abiotically through serpentinised peridotites.
- What do digital databases and nucleosomes have in common?
They both store data!
Part A: Protein Analysis
In this part of the homework, you will be using online resources and 3D visualization software to answer questions about proteins.
What do you know. It's 4am and I've picked this structure which is a domain of a protein that is part of the classification of Circadian Clock Proteins. And in this case specifically from Homo sapiens. I had come across some other CLOCK related proteins but were really confused by their interactions with other proteins and how they were sorted. So I chose to stick with this structure as it was easier to work with and identify certain structural motifs (as this is quite new to me).
Amino Acid Sequence (161 amino acids long): MSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKE The most frequent amino acid: Serine (19). How many protein sequence homologs are there for this protein? pBlast: 98 homologs Resolution: 2.31Å (2.05Å is the median resolution for x-ray crystallographic results in the Protein Data Bank). I do not know enough information on the entire system as this is just one of the domains. The resolution has classified this structure as being of median quality). Protein family: Circadian Clock Proteins
Visualizations
Part B: How to (almost) Fold (almost) Anything
In this part you will be folding protein sequences into 3D structures. The goal is to get an understanding on how computational protein modeling works as well as to see first hand the great computing power needed for molecular simulations in biology.
Folding Online (Robetta)
First, we will use an online Rosetta engine (Robetta) to get the feel of protein folding. Since folding is a computationally intense task, we will choose a protein with less than 100 amino-acids long, so we should get the result back in 2-3 days.
Instruction
- Use RCSB to find a protein with less than 100aa. (Hint: try looking for PDB statistics...)
- Download the pdb file of your choice. And copy it's sequence (can be done in RCSB website, or alternatively in PyMOL).
- Go to Robetta. Register an account.
- Submit your sequence for folding.
- Get the results back in a couple of days.
- Compare to the known protein structure using PyMOL. Notice that while both proteins will have similar structures, they aren't necessarily aligned - you might have to move and rotate them first. Here is a short video tutorial on aligning structures with PyMOL. Post your results.
Here is how Robetta results look like: https://robetta.bakerlab.org/results.php
For this part of the assignment, I ended up searching on UniProt (and had fun learning about the way the database was organized). I narrowed my search down to organism and sequence length, and ended up sending an 84bp sequence to Robetta for folding. The sequence I chose was a toxin "Beta-mammal/insect toxin Ts1" which according to the UniProt datasheet, it says that this is the main neurotoxin of T.serrulatus, also known as the Brazillian Yellow Scorpion. I used to love reading about neurotoxins growing up and was always fascinated by their individual characteristics/ targets. So this exercise really satiated a curiosity/ started a new hobby.





Pro Challenge: Folding Offline (PyRosetta)
By following these instructions, you can install Rosetta on your machine and play around with folding proteins at quicker speeds compared to Robetta.
Instructions
- Install PyRosetta by following the instructions below
- Git clone or download the following GitHub repository: https://github.com/thrakar9/protein_folding_workshop.
- Folding a small (30 aa) peptide.
a. Open the "Protein Folding with Pyrosetta" Jupyter notebook. Execute interactively the code in the notebook and answer the questions therein. When you are done, save the notebook (with the answers and all outputs) to an HTML file, and link it to your class page.
b. Pick the lowest energy model and structurally (visually) compare it to the native. How close is it to the native? If its different, what parts did the computer program get wrong? Note: To compare the structures you have first to align them to the native. You can do that very easily in PyMOL. Here is a short video tutorial on aligning structures with PyMOL
c. Pick the lowest RMSD model and structurally compare it to the native. How close is it to the native? If its different than the lowest energy model, how is it different? Remember that in a blind case, we will not have the benefit of an RMSD column.
- Fold your own sequence!
In question 1 we used the sequence from a human protein as input to the
folding algorithm. Yet, in principle, you can give any arbitrary
sequence of amino acids as an input.
a. Use any process to create a sequence of 30-50 amino acids, and predict it's 3D structure using the notebook from Q1. You can try to run the script with multiple parameter combinations and compare the results. Log the parameters that had the best outcome.
b. Compare the resulting structures of 2(a) with those from question 1. Do the structures in both cases look protein-like ? If not, can you think of an explanation?
c. Try folding multiple sequences to come up with the most protein-looking structure!
Setting up PyRosetta
- Download and install Anaconda.
- Select the Python 3.7 version and follow the instructions to install
- Create a Python 3.6.8 virtual environment with conda
conda create -n protein_design python=3.6.8
- Verify you have the correct Python version by activating the
environment `conda activate protein_design` and executing the command
python. You should an output similar to this:
Python 3.6.8 | Anaconda, Inc. | (default, Dec 29 2018, 19:04:46)[GCC 4.2.1 Compatible Clang 4.0.1 (tags/RELEASE_401/final)] on darwinType "help", "copyright", "credits" or "license" for more information.Download and install PyRosetta
- Select the Python 3.6 version for your system
- Download. Username:
levinthaland PasswordparadoxNote: This combination of username/password is only for academic use.
- Activate the virtual environment we created above:
conda activate protein_design
- Extract and install PyRosetta to the environment.
tar -vjxf PyRosetta-<version>.tar.bz2cd setup && python3.6 setup.py install- Verify the installation in Python.
python3.6 -c "import pyrosetta; pyrosetta.init()"Working with Jupyter notebooks
Jupyter Notebooks are simply amazing. If you haven't used them before, today is your lucky day. Some resources:
- You can save your notebook as an HTML file (
File->Download as->HTML)
Protein folding (structure prediction) webservers
- Download and install Anaconda.
Currently in the process of setting up PyRosetta but I'm having a lot of trouble with ZSH working with Anaconda in Terminal. Will probably explore more of this later on!
3D Print Your Protein!
Instructions
In this part, you can choose any protein structure (rather it's a solved one from RCSB, or one that you folded yourself!) and convert the structure file to an .stl file for 3D printing. We will be printing your protein at MIT using Formlabs and you can pick it up from the MIT Media Lab.
The details of the protocol can be found here: https://www.ascb.org/careers/3d-print-your-favorite-protein
Sending out the protein to be printed.
Part C: Protein Design by Machine Learning
Finally, we would like to design proteins, or optimize existing proteins to have better (or worse) properties and abilities. Over the last few years, machine learning based approaches have revolutionized the protein folding and design field. In this part, we are going to follow along a Jupyter Notebook based on a paper by Facebook AI Research: Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences" (Rives et al., 2020)
Embeddings are a concept in machine learning that started in Natural Language processing and is now used to understand the "language" of protein sequences. Unsupervised ML model is a model that only gets data (X) without any labels, and tries to make sense of the patterns within the data. Embeddings are the product of an unsupervised ML model that tries to transform raw data (e.g. amino acid sequence) into a space while retaining useful properties (e.g. proteins with different biochemical properties will be further apart in that space). What's very useful in embeddings that we can use them for unseen data (e.g. new protein sequence) and get new insights. Another thing we can do is to "travel" within a space - given a protein's embedding, can we make it shine brighter? more hydrophobic? heat-resistant?
In this notebook, we are going to use pre-trained protein embeddings by FAIR to train a downstream model that predicts the effect of missense mutations on the sequence of the protein Beta-lactamase. The original data is from the Envision paper (Gray, et al. 2018)
Instructions
- Open the Google Colab Notebook
- Click "Copy to Drive" to make a copy on your own Google Drive/Colab
- Follow along and run the notebook. While most of it doesn't require any changes, try to understand what each cells does and feel free to play around and break it
- Towards the end, you can choose one of three regressors (feel free to try others). Report in your homework which one you chose and what Spearman correlation score did you get
- What does this all mean? Why is this useful? Last, try to think and design an experiment where machine learning induced protein design can make an impact. Choose a protein of your choice from any animal, plant, fungi, bacteria or virus. Which properties of this protein could you enhance (or diminish) using in-silico design. Can you also think of ways to generate data in the wet lab to be digested by machine learning models (similarly to Rives 2020 and Bryant et al 2020).
K-nearest-neighbors: SpearmanrResult(correlation=0.769765963571508, pvalue=2.162257615831918e-212)
SVM: SpearmanrResult(correlation=0.7802478215668263, pvalue=6.367922915449953e-222)
Random Forest Generator: SpearmanrResult(correlation=0.7200744737184535, pvalue=2.777521793929168e-173)






